Ikwilthepiratebay.nl - Ik wil The Pirate Bay - Informatie omtrent de blokkade

Overview of Ikwilthepiratebay.nl
Ikwilthepiratebay.nl is ranked 192,103 in the world (among the 30 million domains). This site is relatively popular among users in the Netherlands. It gets 94.2% from Netherlands. This site is estimated worth $USD. This site has a good Pagerank(3/10). It has 86 backlinks. It's good for seo website. Ikwilthepiratebay.nl has % seo score.
Rating:
ikwilthepiratebay.nl
3.0/5.0
by
WebstatsDomain
Sponsored links

Sites like ikwilthepiratebay.nl:

The Pirate Bay Android App

piratebayuk.co.uk - Sites like piratebayuk.co.uk

The Pirate Bay Android app. Get all of the latest release info, plus initiate and monitor downloads on your home pc right from your phone.

Tags:Pirate bay, Bay, Android, Pirate bay uk

Pirate Bay

piratebay.com - Sites like piratebay.com

Download, stream and watch movies

Tags:Pirate bay, Torrent, Bittorrent, Torrents

Download Music, Movies, Games, Software! The Pirate Bay Proxy

kuiken.co - Sites like kuiken.co

Download music, movies, games, software and much more. The Pirate Bay is the world's largest bittorrent tracker.

Tags:Pirate bay, Torrent, Bittorrent, Torrents

Pirati.rs - The Pirate Bay Proxy by Serbian Pirates

pirati.rs - Sites like pirati.rs

Download music, movies, games, software and much more. The Pirate Bay is the world's largest bittorrent tracker.

Tags:Pirate bay, Torrent, Bittorrent, Torrents

Google

newstar-krissy.info - Sites like newstar-krissy.info

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

Tags:Pirate bay, Torrent, Torrents, Piratebay

Sponsored links
Thebudcloud - Apple, Android & Www

thebudcloud.com - Sites like thebudcloud.com

Latest tutorials, updates and news about technology and mobile computing.

Tags:Pirate bay, News, Facebook, Android

The Proxy Bay - a List of Pirate Bay Proxy Sites And Mirrors

proxybay.info - Sites like proxybay.info

ProxyBay.info has a list of Pirate Bay Proxy sites. You can use a proxy site to bypass any ISP block for The Pirate Bay

Tags:Bay, Piratebay, Pirate, Proxy

Torrentfreak | Breaking File-sharing, Copyright And Privacy News

torrentfreak.com - Sites like torrentfreak.com

TorrentFreak: The place where breaking news, BitTorrent and copyright collide

Tags:Pirate bay, Torrent, Bittorrent, Torrents

Geekissimo

geekissimo.com - Sites like geekissimo.com

Il Blog tecnologico più letto in Italia. Guide e tutorial su Internet, trucchi per Facebook e Web 2.0 per tutti!

Tags:Pirate bay, Blog, Tecnologia, Web

Musikmarkt - News,neuerscheinungen,events & Interviews | Musikmarkt

musikmarkt.de - Sites like musikmarkt.de

Musikmarkt: Fachmagazin, liefert täglich das Aktuellste aus der Tonträger- und Live-Entertainmentbranche sowie Charts, Neuheiten und Hintergrundinformationen

Tags:Pirate bay, Music, News, Musik news

Pirate Storm | Jeu de Pirates Pour Tous Les Fans D'action

piratestorm.fr - Sites like piratestorm.fr

Pillages et tr sors l gendaires en vue : battez-vous en duel contre des milliers de joueurs. De l action sans piti dans le jeu en ligne Pirate Storm. Jouez !

Tags:Pirate storm, Jeu gratuit en ligne, Jeu par navigateur, Jeux en ligne

Accedere a Pirate Bay Dall'italia - Thepiratebay Italia

thepiratebayitalia.com - Sites like thepiratebayitalia.com

Da questo sito potete accedere a The Pirate Bay dall'Italia, tramite diversi proxy con un click!

Tags:Bay, Thepiratebay, Accedere a thepiratebay, The pirate bay italia

The Pirate Bay Italia - Lotta Per la Liberta' di Accesso

piratebayitalia.com - Sites like piratebayitalia.com

Pirate Bay Italia Sblocco, Come accedere da Italia, How to access the Piratebay from Italy

Tags:Torrent, Bittorrent, Bay, Piratebay

The Pirate Bay Proxy - an Anti-censorship Service to Unblock Access to Thepiratebay

bayproxy.com - Sites like bayproxy.com

BayProxy was setup in protest to the silly censorship era that is trying to take hold. The internet will not let it happen. Use this proxy to access The Pirate Bay.

Tags:Bay, Pirate, Proxy, Thepiratebay

Download Music, Movies, Games, Software! The Pirate Bay - The Galaxy's Most Resilient Bittorren

pirateproxy.net - Sites like pirateproxy.net

Download music, movies, games, software and much more. The Pirate Bay is the world's largest bittorrent tracker.

Tags:Pirate bay, Torrent, Bittorrent, Torrents

Download Music, Movies, Games, Software! The Pirate Bay - The Galaxy's Most Resilient Bittorren

thepiratebay.se - Sites like thepiratebay.se

Download music, movies, games, software and much more. The Pirate Bay is the world's largest bittorrent tracker.

Tags:Pirate bay, Torrent, Bittorrent, Torrents

Ukbay - Tpb Proxy - Download Music, Movies, Games, Software!

ukbay.org - Sites like ukbay.org

UKBay is a PirateBay Proxy created to allow access to ThePirateBay if blocked by your ISP.

Tags:Pirate bay, Piratebay, Proxy, Thepiratebay

Sponsored links

ikwilthepiratebay.nl categories

pirate 329 sites pirate bay 163 sites

Is ikwilthepiratebay.nl safe:

Google Safebrowsing:

Avg Antivirus

Wot Raiting

SiteAdvisor

Child Safety

Copy & paste code at your website:

Sites With a Similar Name:

Domain Google PageRank Alexa Rank Safety
ikwilthuisblijvenwonen.com Google PageRank for ikwilthuisblijvenwonen.com n\a n\a
ikwilhet.nu Google PageRank for ikwilhet.nu 137,635 80/100
ikwilzonneenergie.nl Google PageRank for ikwilzonneenergie.nl 363,705 82/100
ikwilvanmijnautoaf.nl Google PageRank for ikwilvanmijnautoaf.nl 424,302 100/100
ikwilhuren.nu Google PageRank for ikwilhuren.nu 669,216 100/100
ikwilafvallenineenpaarweken.nl Google PageRank for ikwilafvallenineenpaarweken.nl 692,515 n\a
ikwilfilmskijken.com Google PageRank for ikwilfilmskijken.com 912,390 100/100
ikwilnaarnederland.nl Google PageRank for ikwilnaarnederland.nl 1,063,195 80/100
ikwilvanmijnautoaf.be Google PageRank for ikwilvanmijnautoaf.be 1,144,398 100/100
ikwilschoenen.nl Google PageRank for ikwilschoenen.nl 1,266,899 n\a
ikwileenhorloge.nl Google PageRank for ikwileenhorloge.nl 1,510,206 100/100
ikwilwakeboarden.nl Google PageRank for ikwilwakeboarden.nl 1,525,234 n\a
ikwilstarten.be Google PageRank for ikwilstarten.be 1,545,118 100/100
ikwilvanmijnmotorfietsaf.nl Google PageRank for ikwilvanmijnmotorfietsaf.nl 1,676,884 100/100
ikwilnieuweramen.be Google PageRank for ikwilnieuweramen.be 2,127,398 100/100
ikwileenpuppy.be Google PageRank for ikwileenpuppy.be 2,223,364 100/100
ikwiltuinmeubelen.nl Google PageRank for ikwiltuinmeubelen.nl 2,273,197 100/100
ikwilzorgelooshuren.nl Google PageRank for ikwilzorgelooshuren.nl 3,014,859 100/100
ikwilvanille.nl Google PageRank for ikwilvanille.nl 3,102,244 n\a
ikwilgraffiti.nl Google PageRank for ikwilgraffiti.nl 3,127,820 n\a

ikwilthepiratebay.nl in Other TLD:

Domain Google PageRank Alexa Rank Safety
ikwilthepiratebay.org Google PageRank for ikwilthepiratebay.org 217,701 n\a
ikwilthepiratebay.com Google PageRank for ikwilthepiratebay.com n\a 100/100

Summary statistics for ikwilthepiratebay.nl

Title: Ik wil The Pirate Bay - Informatie omtrent de blokkade
Alexa Rank: 192,103
Pagerank: Check google pagerank for ikwilthepiratebay.nl Take this button and put in your website
Website Worth:
SEO score:
Date Registered:
Site Age:
Pageviews per User: 1
Average Time on Site: 00:36
Search Percent:
Estimated percentage of visits to ikwilthepiratebay.nl that came from a search engine
27.6%
Bounce:
Estimated percentage of visits to ikwilthepiratebay.nl that consist of a single pageview
47.1%
Primary Country:
The country where current domain is most popular relative to the other countries
Netherlands
IP-address:
Alexa backlinks: 86
Magestic Backlinks: Picture shows the External Backlinks found over the last month

Traffic Report for ikwilthepiratebay.nl:

Traffic Rank
Traffic rank for ikwilthepiratebay.nl, a low rank means that this website gets lots of visitors
Reach
Estimated percentage of global internet users who visit ikwilthepiratebay.nl
Pageviews
Estimated percentage of global pageviews on ikwilthepiratebay.nl
Pageviews/User
Estimated daily unique pageviews per user for ikwilthepiratebay.nl
Bounce %
Estimated percentage of visits to ikwilthepiratebay.nl that consist of a single pageview
Time on Site
Estimated daily time on site (mm:ss) for ikwilthepiratebay.nl
Search %
Estimated percentage of visits to ikwilthepiratebay.nl that came from a search engine
Daily Pageviews: 0.0000097 (estimated)
Alexa Rank: 192,103 visit alexa
Alexa Reach: 0.00095% (Percent of global Internet users)
Alexa BackLinks: 86
This report show rough estimate of ikwilthepiratebay.nl's popularity
Compete.com
See monthly traffic, unique visitors, rank and more for ikwilthepiratebay.nl with Compete's free Site Analytics.
Quantcast.com
ikwilthepiratebay.nl's audience profile on Quantcast shows estimated traffic, demographic and affinity data. Getting Quantified means free, directly measured and reliable audience data for this web property, or any other. Visit Quantcast.com for more information.

Visitors by Country for ikwilthepiratebay.nl:

Percent of Visitors

Country

Netherlands 94.2

Whois Lookup For ikwilthepiratebay.nl: